Gold Member Since 2015
Audited Supplier
Zhuhaishi Shuangbojie Technology Co., Ltd.

Glucagon, Glucagon Powder, Glucagon Peptides manufacturer / supplier in China, offering New Arrival Peptides Glucagon Powder 16941-32-5, Nandrolone Decanoate (Deca Durabolin) Increase Androgen to Treat Anemia, Peptdies Powder Dsip Help Male Growth and Development 62568-57-4 and so on.

(/ )

Supplier Homepage Product Peptides and human growth steroid New Arrival Peptides Glucagon Powder 16941-32-5

New Arrival Peptides Glucagon Powder 16941-32-5

FOB Price: US $1-10 / g
Min. Order: 10 g
Min. Order FOB Price
10 g US $1-10/ g
Get Latest Price
Production Capacity: 1000kg/Mouth
Transport Package: Foil Bag
Payment Terms: T/T, Western Union, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: 16941-32-5
  • Customized: Customized
  • Suitable for: Adult
  • Purity: >99%
  • Glucagon Other Name: (-)-Adrenalinehydrochlorid
  • Glucagon Assay: 98%
  • Glucagon M.W.: 219.67
  • Glucagon Paacking: Foil Bag
  • Glucagon Express: TNT, UPS, DHL, EMS, Hkems, FedEx
  • Specification: GMP
  • HS Code: 3001200020
  • Powder: Yes
  • Certification: ISO 9001
  • State: Solid
  • Glucagon Product Name: L-Epinephrine Hydrochloride
  • Glucagon CAS No.: 55-31-2
  • Glucagon M.F.: C9h14clno3
  • Glucagon Appearance: White Crystalline Powder
  • Glucagon Delivery: Within 24hours After Your Payment
  • Trademark: SBJ
  • Origin: China
Product Description

New Arrival Peptides Glucagon Powder 16941-32-5

Glucagon
\Glucagon Product Name: Glucagon
Glucagon Synonyms: GLUCAGON 1-37; GLUCAGON (1-37) (PORCINE); GLUCAGON 37; GLUCAGON ACETATE; HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA; H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH; OXYNTOMODULIN (PORCINE); OXYNTOMODULIN
Glucagon CAS: 16941-32-5
Glucagon MF: C153H225N43O49S
Glucagon MW: 3482.75
Glucagon EINECS: 232-708-2
Glucagon Product Categories: Amino Acid Derivatives; Peptide; GlucagonIslet Stem Cell Biology; Islet Stem Cell Differentiation; Hormones; Other Protein/Peptide Hormones; Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology; GlucagonsIslet Stem Cell Biology; Cytokines Growth Factors and Hormones (Obesity); Gastrointestinal Peptides; GlucagonObesity Research; API; Diabetes Research
Glucagon Mol File: 16941-32-5. mol

Glucagon Description:
Glucagon is also known as glucagon or anti insulin or insulin B. It is accompanied by a hormone insulin secretion from pancreatic islet alpha cells of vertebrates. Confrontation and insulin plays a role, increase blood glucose. In 1953, was isolated by precipitation and obtain the crystallization. It is based on the N- terminal histidine as a starting point, C terminal threonine is a single chain peptide terminus of 29 amino acids (molecular weight is about 3500), does not have the S-S bonds in a molecule, at this point, completely different from insulin. The structure of the compound has been synthesized by chemical recent affirmation. The early effect of glucagon process is specific binding exists in the target cell receptors on the cell membrane, the adenylate cyclase activation, ring type AMP as the second messenger activating phosphorylase, promoting glycogenolysis.

Glucagon Application:
In contrast to the action of insulin, glucagon is a promoting hormone catabolism. Glucagon has very strong promoting glycogenolysis and gluconeogenesis, make the blood glucose increased significantly, 1mol/L hormone can make 3 x 106mol/L glucose from glycogen decomposed rapidly out. Glucagon by cAMP-PK system, the activation of hepatic cells accelerated glycogen phosphorylase, decomposition. Gluconeogenesis is enhanced because hormone accelerate amino acids into liver cells, and activate the enzyme of gluconeogenesis.

What You Can Choose 
MGF2mg/vialAlarelin Acetate1g/vial
PEG MGF2mg/vialAngiotensin1g/bag
CJC-1295 with DAC2mg/vialArgipressin1g/vial
CJC-12952mg/vialArgireline10g/vials
PT-14110mg/vialAtosiban1g/vial
MT-1(Melanotan)10mg/vialBivalirudinCustomized
MT-210mg/vialCetrorelix1g/bag
GHRP-25mg/vialDesmopressin acetate1g/bag
GHRP-210mg/vialEnfuvirtide1g/bag
GHRP-65mg/vialEptifibatide1g/bag
GHRP-610mg/vialExenatide acetate1g/bag
iPamorelin2mg/vialGlucagon1g/bag
Hexarelin2mg/vialLeuprorelin1g/vial
Sermorelin2mg/vialLipopeptide1g/vial
Oxytocin2mg/vialMatrixyl100g/bag
TB5002mg/vialNesiritide AcetateCustomized
Pentadecapeptide BPC 1572mg/vialOctreotide acetateCustomized
    
Triptorelin2mg/vialSalcitonin1g/bag
Tesamorelin2mg/vialSomatostatin1g/vial
Gonadorelin2mg/vialTeriparatide acetate1g/bag
Gonadorelin10mg/vialTerlipressin Acetate1g/vial
DSIP 2mg/vialThymopentin1g/bag
Selank5mg/vialThymosin α1 Acetate10mg/vial
Epitalon10mg/vialZiconotide acetateCustomized  

About Us
Zhuhaishi Shuangbojie Technology Co., Ltd, a leading manufacturer and supplier of fine chemicals in China, is located in Zhuhai City Guangdong Province. Our company's various chemical raw material products have stable and reliable quality, it is mainly sold to pharmacy company and health care company in abroad, like USA, Canada, UK, Brazil, Netherlands, Ireland, New Zealand, Austria, Australia and so on. 

The products achieve the advanced standard of domestic market, most of which even reach the international standard and conform to the requirements of FCC, USP, EP and BP with high level research group, advanced apparatus and good scientific atmosphere which ensure the stable and reliable quality. Besides, the factory has a complete Q. A. & Q. C. System. We own authorized sets of analyzing instruments that have high efficiency and high sensitivity, such as HPLC, GC and UV spectrophotometer to analyze and control the products. 

Our company will take high-quality products, the most preferential prices and the most considerate service for your satisfaction. We look forward to opportunities for business cooperation with you. 

New Arrival Peptides Glucagon Powder 16941-32-5
Send your message to this supplier
Avatar
Mr. Wilson
*From:
To: Mr. Wilson
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category